Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 637370..638169 | Replicon | chromosome |
| Accession | NZ_CP102244 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A369FDQ4 |
| Locus tag | NQZ80_RS03070 | Protein ID | WP_000347280.1 |
| Coordinates | 637370..637834 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NQZ80_RS03075 | Protein ID | WP_001307405.1 |
| Coordinates | 637834..638169 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS03040 (632371) | 632371..632805 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NQZ80_RS03045 (632823) | 632823..633701 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NQZ80_RS03050 (633691) | 633691..634470 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NQZ80_RS03055 (634481) | 634481..634954 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NQZ80_RS03060 (634977) | 634977..636257 | - | 1281 | WP_000681960.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NQZ80_RS03065 (636506) | 636506..637315 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| NQZ80_RS03070 (637370) | 637370..637834 | - | 465 | WP_000347280.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NQZ80_RS03075 (637834) | 637834..638169 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NQZ80_RS03080 (638318) | 638318..639889 | - | 1572 | WP_024216579.1 | galactarate dehydratase | - |
| NQZ80_RS03085 (640264) | 640264..641598 | + | 1335 | WP_024046198.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NQZ80_RS03090 (641614) | 641614..642384 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17862.29 Da Isoelectric Point: 9.6924
>T253354 WP_000347280.1 NZ_CP102244:c637834-637370 [Escherichia coli O7:H15]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A369FDQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |