Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 86451..86720 | Replicon | plasmid pS270V-2 |
Accession | NZ_CP102196 | ||
Organism | Klebsiella pneumoniae strain S270v |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | NQZ65_RS28835 | Protein ID | WP_001372321.1 |
Coordinates | 86595..86720 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 86451..86516 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ65_RS28805 | 82161..82688 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
NQZ65_RS28810 | 82746..82979 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
NQZ65_RS28815 | 83040..85063 | + | 2024 | Protein_117 | ParB/RepB/Spo0J family partition protein | - |
NQZ65_RS28820 | 85132..85566 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
NQZ65_RS28825 | 85563..86282 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 86294..86518 | + | 225 | NuclAT_0 | - | - |
- | 86294..86518 | + | 225 | NuclAT_0 | - | - |
- | 86294..86518 | + | 225 | NuclAT_0 | - | - |
- | 86294..86518 | + | 225 | NuclAT_0 | - | - |
- | 86451..86516 | - | 66 | - | - | Antitoxin |
NQZ65_RS28830 | 86504..86653 | + | 150 | Protein_120 | plasmid maintenance protein Mok | - |
NQZ65_RS28835 | 86595..86720 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
NQZ65_RS28840 | 87039..87335 | - | 297 | Protein_122 | hypothetical protein | - |
NQZ65_RS28845 | 87635..87931 | + | 297 | WP_001272251.1 | hypothetical protein | - |
NQZ65_RS28850 | 88042..88863 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
NQZ65_RS28855 | 89160..89807 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
NQZ65_RS28860 | 90084..90467 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
NQZ65_RS28865 | 90658..91344 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
NQZ65_RS28870 | 91438..91665 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaTEM-1B / blaKPC-2 / blaSHV-12 / cmlA1 / qacE / blaCTX-M-14 | - | 1..154868 | 154868 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T253346 WP_001372321.1 NZ_CP102196:86595-86720 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT253346 NZ_CP102196:c86516-86451 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|