Detailed information of TA system TA253345

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 86294..86720
• Replicon: plasmid pS270V-2
• Accession: NZ_CP102196
• Organism: Klebsiella pneumoniae strain S270v

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NQZ65_RS28835
• Protein ID: WP_001372321.1
• Coordinates: 86595..86720 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	86294..86518 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NQZ65_RS28800 (81404)	81404..81859	-	456	Protein_114	hypothetical protein	-
NQZ65_RS28805 (82161)	82161..82688	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
NQZ65_RS28810 (82746)	82746..82979	+	234	WP_000006003.1	DUF905 family protein	-
NQZ65_RS28815 (83040)	83040..85063	+	2024	Protein_117	ParB/RepB/Spo0J family partition protein	-
NQZ65_RS28820 (85132)	85132..85566	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NQZ65_RS28825 (85563)	85563..86282	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
- (86294)	86294..86518	+	225	NuclAT_0	-	Antitoxin
- (86294)	86294..86518	+	225	NuclAT_0	-	Antitoxin
- (86294)	86294..86518	+	225	NuclAT_0	-	Antitoxin
- (86294)	86294..86518	+	225	NuclAT_0	-	Antitoxin
NQZ65_RS28830 (86504)	86504..86653	+	150	Protein_120	plasmid maintenance protein Mok	-
NQZ65_RS28835 (86595)	86595..86720	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NQZ65_RS28840 (87039)	87039..87335	-	297	Protein_122	hypothetical protein	-
NQZ65_RS28845 (87635)	87635..87931	+	297	WP_001272251.1	hypothetical protein	-
NQZ65_RS28850 (88042)	88042..88863	+	822	WP_001234445.1	DUF932 domain-containing protein	-
NQZ65_RS28855 (89160)	89160..89807	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
NQZ65_RS28860 (90084)	90084..90467	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NQZ65_RS28865 (90658)	90658..91344	+	687	WP_015059009.1	PAS domain-containing protein	-
NQZ65_RS28870 (91438)	91438..91665	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaTEM-1B / blaKPC-2 / blaSHV-12 / cmlA1 / qacE / blaCTX-M-14	-	1..154868	154868

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T253345 WP_001372321.1 NZ_CP102196:86595-86720 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT253345 NZ_CP102196:86294-86518 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin