Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 33254..33507 | Replicon | plasmid pS270V-2 |
| Accession | NZ_CP102196 | ||
| Organism | Klebsiella pneumoniae strain S270v | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NQZ65_RS28495 | Protein ID | WP_001312851.1 |
| Coordinates | 33358..33507 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 33254..33313 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ65_RS28455 (28636) | 28636..28980 | - | 345 | Protein_45 | IS6-like element IS26 family transposase | - |
| NQZ65_RS28460 (29032) | 29032..29736 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NQZ65_RS28465 (29761) | 29761..29961 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NQZ65_RS28470 (29981) | 29981..30727 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NQZ65_RS28475 (30782) | 30782..31342 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NQZ65_RS28480 (31474) | 31474..31674 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NQZ65_RS28485 (32060) | 32060..32659 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NQZ65_RS28490 (32721) | 32721..33053 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (33254) | 33254..33313 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (33254) | 33254..33313 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (33254) | 33254..33313 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (33254) | 33254..33313 | - | 60 | NuclAT_1 | - | Antitoxin |
| NQZ65_RS28495 (33358) | 33358..33507 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NQZ65_RS28500 (33791) | 33791..34039 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NQZ65_RS28505 (34154) | 34154..34332 | + | 179 | Protein_55 | protein CopA/IncA | - |
| NQZ65_RS28510 (34351) | 34351..35208 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NQZ65_RS28515 (36147) | 36147..36800 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NQZ65_RS28520 (36893) | 36893..37150 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NQZ65_RS28525 (37083) | 37083..37484 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NQZ65_RS28530 (37733) | 37733..38148 | + | 416 | Protein_60 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaTEM-1B / blaKPC-2 / blaSHV-12 / cmlA1 / qacE / blaCTX-M-14 | - | 1..154868 | 154868 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T253342 WP_001312851.1 NZ_CP102196:33358-33507 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT253342 NZ_CP102196:c33313-33254 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
