Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67054..67307 | Replicon | plasmid pS234-4 |
| Accession | NZ_CP102190 | ||
| Organism | Klebsiella pneumoniae strain S234 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NQZ63_RS29295 | Protein ID | WP_001312851.1 |
| Coordinates | 67054..67203 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 67248..67307 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ63_RS29260 (62413) | 62413..62828 | - | 416 | Protein_74 | IS1 family transposase | - |
| NQZ63_RS29265 (63077) | 63077..63478 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NQZ63_RS29270 (63411) | 63411..63668 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NQZ63_RS29275 (63761) | 63761..64414 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NQZ63_RS29280 (65353) | 65353..66210 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NQZ63_RS29285 (66229) | 66229..66407 | - | 179 | Protein_79 | protein CopA/IncA | - |
| NQZ63_RS29290 (66522) | 66522..66770 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NQZ63_RS29295 (67054) | 67054..67203 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (67248) | 67248..67307 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (67248) | 67248..67307 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (67248) | 67248..67307 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (67248) | 67248..67307 | + | 60 | NuclAT_0 | - | Antitoxin |
| NQZ63_RS29300 (67508) | 67508..67840 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| NQZ63_RS29305 (67902) | 67902..68501 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NQZ63_RS29310 (68887) | 68887..69087 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| NQZ63_RS29315 (69219) | 69219..69779 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NQZ63_RS29320 (69834) | 69834..70580 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NQZ63_RS29325 (70600) | 70600..70800 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| NQZ63_RS29330 (70825) | 70825..71529 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NQZ63_RS29335 (71581) | 71581..71925 | + | 345 | Protein_89 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | cmlA1 / qacE / blaCTX-M-14 / blaTEM-1B | - | 1..87177 | 87177 | |
| - | inside | IScluster/Tn | cmlA1 / qacE / blaCTX-M-14 / blaTEM-1B | - | 30171..62828 | 32657 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T253320 WP_001312851.1 NZ_CP102190:c67203-67054 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT253320 NZ_CP102190:67248-67307 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
