Detailed information of TA system TA253313

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 95318..95744
• Replicon: plasmid pS234-2
• Accession: NZ_CP102188
• Organism: Klebsiella pneumoniae strain S234

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NQZ63_RS28470
• Protein ID: WP_001372321.1
• Coordinates: 95318..95443 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	95520..95744 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NQZ63_RS28435 (90715)	90715..91695	-	981	WP_013213985.1	IS481-like element ISKpn27 family transposase	-
NQZ63_RS28440 (91818)	91818..92279	-	462	Protein_101	recombinase family protein	-
NQZ63_RS28445 (92331)	92331..93035	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
NQZ63_RS28450 (93099)	93099..93383	-	285	Protein_103	PAS domain-containing protein	-
NQZ63_RS28455 (93449)	93449..94153	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
NQZ63_RS28460 (94206)	94206..94403	-	198	Protein_105	hypothetical protein	-
NQZ63_RS28465 (94703)	94703..94999	+	297	Protein_106	hypothetical protein	-
NQZ63_RS28470 (95318)	95318..95443	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NQZ63_RS28475 (95385)	95385..95534	-	150	Protein_108	plasmid maintenance protein Mok	-
- (95520)	95520..95744	-	225	NuclAT_0	-	Antitoxin
- (95520)	95520..95744	-	225	NuclAT_0	-	Antitoxin
- (95520)	95520..95744	-	225	NuclAT_0	-	Antitoxin
- (95520)	95520..95744	-	225	NuclAT_0	-	Antitoxin
NQZ63_RS28480 (95756)	95756..96475	-	720	WP_001276217.1	plasmid SOS inhibition protein A	-
NQZ63_RS28485 (96472)	96472..96906	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NQZ63_RS28490 (96975)	96975..98998	-	2024	Protein_111	ParB/RepB/Spo0J family partition protein	-
NQZ63_RS28495 (99059)	99059..99292	-	234	WP_000006003.1	DUF905 family protein	-
NQZ63_RS28500 (99350)	99350..99877	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
NQZ63_RS28505 (100179)	100179..100646	+	468	Protein_114	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	catA2 / dfrA14 / sul2 / qnrS1 / blaLAP-2 / blaKPC-2 / blaSHV-12 / tet(A)	-	1..146760	146760

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T253313 WP_001372321.1 NZ_CP102188:c95443-95318 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT253313 NZ_CP102188:c95744-95520 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin