Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
| Location | 1115103..1115755 | Replicon | chromosome |
| Accession | NZ_CP102180 | ||
| Organism | Ralstonia solanacearum strain Bs715 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A454TTN3 |
| Locus tag | NQ321_RS04545 | Protein ID | WP_038962847.1 |
| Coordinates | 1115103..1115447 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NQ321_RS04550 | Protein ID | WP_020425351.1 |
| Coordinates | 1115444..1115755 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ321_RS04530 | 1110799..1111962 | - | 1164 | WP_011003438.1 | 2-methylcitrate synthase | - |
| NQ321_RS04535 | 1112014..1112910 | - | 897 | WP_020425352.1 | methylisocitrate lyase | - |
| NQ321_RS04540 | 1113103..1115052 | + | 1950 | WP_118888105.1 | propionate catabolism operon regulatory protein PrpR | - |
| NQ321_RS04545 | 1115103..1115447 | + | 345 | WP_038962847.1 | hypothetical protein | Toxin |
| NQ321_RS04550 | 1115444..1115755 | + | 312 | WP_020425351.1 | transcriptional regulator | Antitoxin |
| NQ321_RS04555 | 1115895..1116704 | - | 810 | WP_043885575.1 | DUF2242 domain-containing protein | - |
| NQ321_RS04560 | 1117991..1119787 | + | 1797 | WP_118912045.1 | 3'-5' exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1115103..1155304 | 40201 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13227.94 Da Isoelectric Point: 8.4489
>T253291 WP_038962847.1 NZ_CP102180:1115103-1115447 [Ralstonia solanacearum]
MDATFIELPPFQRLREHYLSDDEYRALQQELLARPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIDYHWDGGGQFWM
FVVYDKGEADDLSSDERKVLARLLEQEVKARSER
MDATFIELPPFQRLREHYLSDDEYRALQQELLARPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIDYHWDGGGQFWM
FVVYDKGEADDLSSDERKVLARLLEQEVKARSER
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|