Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 1098514..1099169 | Replicon | chromosome |
Accession | NZ_CP102179 | ||
Organism | Pseudomonas canavaninivorans strain B21-020 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | LOY40_RS04795 | Protein ID | WP_030139927.1 |
Coordinates | 1098514..1098858 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A923JRE9 |
Locus tag | LOY40_RS04800 | Protein ID | WP_030139928.1 |
Coordinates | 1098855..1099169 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY40_RS04770 (LOY40_04770) | 1093527..1094474 | + | 948 | WP_181287658.1 | ubiquinol oxidase subunit II | - |
LOY40_RS04775 (LOY40_04775) | 1094478..1096508 | + | 2031 | WP_030139923.1 | cytochrome o ubiquinol oxidase subunit I | - |
LOY40_RS04780 (LOY40_04780) | 1096512..1097138 | + | 627 | WP_030139924.1 | cytochrome o ubiquinol oxidase subunit III | - |
LOY40_RS04785 (LOY40_04785) | 1097139..1097474 | + | 336 | WP_041022358.1 | cytochrome o ubiquinol oxidase subunit IV | - |
LOY40_RS04790 (LOY40_04790) | 1097486..1098373 | + | 888 | WP_258648935.1 | heme o synthase | - |
LOY40_RS04795 (LOY40_04795) | 1098514..1098858 | + | 345 | WP_030139927.1 | toxin | Toxin |
LOY40_RS04800 (LOY40_04800) | 1098855..1099169 | + | 315 | WP_030139928.1 | helix-turn-helix domain-containing protein | Antitoxin |
LOY40_RS04805 (LOY40_04805) | 1099363..1100067 | - | 705 | WP_258648937.1 | hypothetical protein | - |
LOY40_RS04810 (LOY40_04810) | 1100189..1100932 | - | 744 | WP_258648938.1 | DUF72 domain-containing protein | - |
LOY40_RS04815 (LOY40_04815) | 1101009..1102022 | - | 1014 | WP_030139931.1 | sensor domain-containing diguanylate cyclase | - |
LOY40_RS04820 (LOY40_04820) | 1102191..1103093 | - | 903 | WP_217861283.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13804.76 Da Isoelectric Point: 9.6383
>T253287 WP_030139927.1 NZ_CP102179:1098514-1098858 [Pseudomonas canavaninivorans]
MRTLFFETTTFTATVGHYLTDDEYRLLQFYMQQHPEAGDVMPRTGGFRKLRWFDERRGKGKRGGLRVIYYWLRHDRQFWM
FAIYDKDELENLTSEQEKTLKRAIEAELKVRGTL
MRTLFFETTTFTATVGHYLTDDEYRLLQFYMQQHPEAGDVMPRTGGFRKLRWFDERRGKGKRGGLRVIYYWLRHDRQFWM
FAIYDKDELENLTSEQEKTLKRAIEAELKVRGTL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|