Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 6078989..6079658 | Replicon | chromosome |
Accession | NZ_CP102177 | ||
Organism | Pseudomonas corrugata strain B21-055 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | LOY64_RS27220 | Protein ID | WP_055136377.1 |
Coordinates | 6079293..6079658 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A3M3EAW2 |
Locus tag | LOY64_RS27215 | Protein ID | WP_024779393.1 |
Coordinates | 6078989..6079300 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY64_RS27205 (LOY64_27220) | 6075033..6078776 | + | 3744 | WP_265068323.1 | bifunctional diguanylate cyclase/phosphodiesterase | - |
LOY64_RS27215 (LOY64_27230) | 6078989..6079300 | - | 312 | WP_024779393.1 | XRE family transcriptional regulator | Antitoxin |
LOY64_RS27220 (LOY64_27235) | 6079293..6079658 | - | 366 | WP_055136377.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LOY64_RS27225 (LOY64_27240) | 6079942..6082305 | + | 2364 | WP_265068324.1 | hypothetical protein | - |
LOY64_RS27230 (LOY64_27245) | 6082342..6082803 | + | 462 | WP_024779396.1 | Lrp/AsnC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14038.73 Da Isoelectric Point: 5.5787
>T253284 WP_055136377.1 NZ_CP102177:c6079658-6079293 [Pseudomonas corrugata]
MKWDVEYTDEFEIWWNRLGESEQDSVQASVMLLGDAGPFLGFPHTSDIKGSRHGNLRELRVQHGGRPYRVLYAFDPRRCA
ILLIGGGKTGQDRWYHEYVPLAERLYDEHLEVLKKEGFDNG
MKWDVEYTDEFEIWWNRLGESEQDSVQASVMLLGDAGPFLGFPHTSDIKGSRHGNLRELRVQHGGRPYRVLYAFDPRRCA
ILLIGGGKTGQDRWYHEYVPLAERLYDEHLEVLKKEGFDNG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|