Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 5626643..5627312 | Replicon | chromosome |
| Accession | NZ_CP102175 | ||
| Organism | Pseudomonas corrugata strain B21-061 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | LOY65_RS24800 | Protein ID | WP_055136377.1 |
| Coordinates | 5626947..5627312 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A3M3EAW2 |
| Locus tag | LOY65_RS24795 | Protein ID | WP_024779393.1 |
| Coordinates | 5626643..5626954 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOY65_RS24785 (LOY65_24790) | 5622226..5625273 | - | 3048 | WP_265075431.1 | DEAD/DEAH box helicase | - |
| LOY65_RS24790 (LOY65_24795) | 5625278..5626111 | - | 834 | WP_265075432.1 | DUF1837 domain-containing protein | - |
| LOY65_RS24795 (LOY65_24800) | 5626643..5626954 | - | 312 | WP_024779393.1 | XRE family transcriptional regulator | Antitoxin |
| LOY65_RS24800 (LOY65_24805) | 5626947..5627312 | - | 366 | WP_055136377.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LOY65_RS24805 (LOY65_24810) | 5627596..5629959 | + | 2364 | WP_265068324.1 | hypothetical protein | - |
| LOY65_RS24810 (LOY65_24815) | 5629996..5630457 | + | 462 | WP_024779396.1 | Lrp/AsnC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5606830..5635347 | 28517 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14038.73 Da Isoelectric Point: 5.5787
>T253275 WP_055136377.1 NZ_CP102175:c5627312-5626947 [Pseudomonas corrugata]
MKWDVEYTDEFEIWWNRLGESEQDSVQASVMLLGDAGPFLGFPHTSDIKGSRHGNLRELRVQHGGRPYRVLYAFDPRRCA
ILLIGGGKTGQDRWYHEYVPLAERLYDEHLEVLKKEGFDNG
MKWDVEYTDEFEIWWNRLGESEQDSVQASVMLLGDAGPFLGFPHTSDIKGSRHGNLRELRVQHGGRPYRVLYAFDPRRCA
ILLIGGGKTGQDRWYHEYVPLAERLYDEHLEVLKKEGFDNG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|