Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5848440..5849035 | Replicon | chromosome |
Accession | NZ_CP102174 | ||
Organism | Pseudomonas aeruginosa strain PA5083 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | NQ602_RS27380 | Protein ID | WP_003113526.1 |
Coordinates | 5848757..5849035 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NQ602_RS27375 | Protein ID | WP_003133769.1 |
Coordinates | 5848440..5848745 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ602_RS27360 (NQ602_27360) | 5845146..5846009 | - | 864 | WP_031761182.1 | integrase domain-containing protein | - |
NQ602_RS27365 (NQ602_27365) | 5846610..5847767 | - | 1158 | WP_031761183.1 | STY4528 family pathogenicity island replication protein | - |
NQ602_RS27375 (NQ602_27375) | 5848440..5848745 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
NQ602_RS27380 (NQ602_27380) | 5848757..5849035 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQ602_RS27385 (NQ602_27385) | 5849088..5849216 | - | 129 | Protein_5413 | integrase | - |
NQ602_RS27390 (NQ602_27390) | 5849364..5851592 | + | 2229 | WP_023104079.1 | TonB-dependent receptor | - |
NQ602_RS27395 (NQ602_27395) | 5851663..5852310 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
NQ602_RS27400 (NQ602_27400) | 5852372..5853610 | - | 1239 | WP_003095023.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T253272 WP_003113526.1 NZ_CP102174:c5849035-5848757 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|