Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-couple_hipB |
Location | 713092..713746 | Replicon | chromosome |
Accession | NZ_CP102148 | ||
Organism | Streptococcus suis strain DNC15 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NQZ90_RS03465 | Protein ID | WP_257110357.1 |
Coordinates | 713092..713457 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G7SDV1 |
Locus tag | NQZ90_RS03470 | Protein ID | WP_014637767.1 |
Coordinates | 713447..713746 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ90_RS03450 (NQZ90_03450) | 709282..709875 | - | 594 | WP_105155429.1 | DUF1361 domain-containing protein | - |
NQZ90_RS03455 (NQZ90_03455) | 710031..712034 | + | 2004 | WP_044685961.1 | methionine--tRNA ligase | - |
NQZ90_RS03460 (NQZ90_03460) | 712095..713048 | + | 954 | WP_044669863.1 | competence protein CoiA family protein | - |
NQZ90_RS03465 (NQZ90_03465) | 713092..713457 | + | 366 | WP_257110357.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQZ90_RS03470 (NQZ90_03470) | 713447..713746 | + | 300 | WP_014637767.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NQZ90_RS03475 (NQZ90_03475) | 713856..715658 | + | 1803 | WP_024389335.1 | oligoendopeptidase F | - |
NQZ90_RS03480 (NQZ90_03480) | 715660..716103 | + | 444 | WP_024389334.1 | hypothetical protein | - |
NQZ90_RS03485 (NQZ90_03485) | 716114..716662 | + | 549 | WP_024389333.1 | hypothetical protein | - |
NQZ90_RS03490 (NQZ90_03490) | 716737..717456 | + | 720 | WP_044669888.1 | O-methyltransferase | - |
NQZ90_RS03495 (NQZ90_03495) | 717518..718501 | + | 984 | WP_014637772.1 | peptidylprolyl isomerase PrsA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14507.73 Da Isoelectric Point: 10.0120
>T253246 WP_257110357.1 NZ_CP102148:713092-713457 [Streptococcus suis]
MYTIYFYKDKNGREPVLEYLRELASKKEKDSRIKLNKINDYIELLSQLGTQIGEPYVKHLEGNIWELRPLRDRILFVAWY
DGSFVLLHHFVKRSQKTPRRELEKAQRELADLKERGINNGK
MYTIYFYKDKNGREPVLEYLRELASKKEKDSRIKLNKINDYIELLSQLGTQIGEPYVKHLEGNIWELRPLRDRILFVAWY
DGSFVLLHHFVKRSQKTPRRELEKAQRELADLKERGINNGK
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|