Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 1954792..1955311 Replicon chromosome
Accession NZ_CP102138
Organism Streptococcus suis strain M102942_S11

Toxin (Protein)


Gene name yoeB Uniprot ID A0A0K2E7Z7
Locus tag NQZ95_RS09605 Protein ID WP_013730620.1
Coordinates 1954792..1955049 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A0K2E7Z9
Locus tag NQZ95_RS09610 Protein ID WP_002939010.1
Coordinates 1955051..1955311 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ95_RS09590 (NQZ95_09590) 1951263..1952993 - 1731 WP_009910905.1 membrane protein -
NQZ95_RS09595 (NQZ95_09595) 1953356..1954228 - 873 WP_009910907.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NQZ95_RS09600 (NQZ95_09600) 1954248..1954778 - 531 WP_009910909.1 DUF1697 domain-containing protein -
NQZ95_RS09605 (NQZ95_09605) 1954792..1955049 - 258 WP_013730620.1 Txe/YoeB family addiction module toxin Toxin
NQZ95_RS09610 (NQZ95_09610) 1955051..1955311 - 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NQZ95_RS09615 (NQZ95_09615) 1955387..1955842 - 456 WP_013730621.1 8-oxo-dGTP diphosphatase -
NQZ95_RS09620 (NQZ95_09620) 1955846..1956058 - 213 WP_257105089.1 hypothetical protein -
NQZ95_RS09625 (NQZ95_09625) 1956067..1956213 - 147 WP_257105090.1 hypothetical protein -
NQZ95_RS09630 (NQZ95_09630) 1956206..1956775 - 570 WP_022540720.1 ribonuclease M5 -
NQZ95_RS09635 (NQZ95_09635) 1956759..1957541 - 783 WP_002939015.1 TatD family hydrolase -
NQZ95_RS09640 (NQZ95_09640) 1957649..1957786 - 138 WP_002939016.1 50S ribosomal protein L34 -
NQZ95_RS09645 (NQZ95_09645) 1957954..1958949 - 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -
NQZ95_RS09650 (NQZ95_09650) 1958969..1959781 - 813 WP_012027897.1 YidC/Oxa1 family membrane protein insertase -
NQZ95_RS09655 (NQZ95_09655) 1959765..1960124 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1941998..1957541 15543


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10346.86 Da        Isoelectric Point: 8.0279

>T253219 WP_013730620.1 NZ_CP102138:c1955049-1954792 [Streptococcus suis]
MGIHFTDDAWEDYLYWQGQDKKTLKRINKIIKDMQRHPFEGIAKPEPLKYDYQGAWSRRIDAENRLIYMVEADRLCILSL
KDHYR

Download         Length: 258 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9980.36 Da        Isoelectric Point: 5.7134

>AT253219 WP_002939010.1 NZ_CP102138:c1955311-1955051 [Streptococcus suis]
MEAIVYSHFRNHLKDYMKKVNDEFEPLVVVNKNPEEDIVVLSKSEWDSLQETLAVARNTYLSQKVLRGMAKVKTGQTQER
NLIEAD

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K2E7Z7

Antitoxin

Source ID Structure
AlphaFold DB A0A0K2E7Z9

References