Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 1082068..1082701 | Replicon | chromosome |
| Accession | NZ_CP102097 | ||
| Organism | Vibrio japonicus strain JCM 31412 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NP165_RS18260 | Protein ID | WP_140139435.1 |
| Coordinates | 1082369..1082701 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NP165_RS18255 | Protein ID | WP_140139434.1 |
| Coordinates | 1082068..1082382 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP165_RS18230 (NP165_18230) | 1077725..1077814 | + | 90 | WP_074190930.1 | DUF3265 domain-containing protein | - |
| NP165_RS18235 (NP165_18235) | 1078109..1079062 | - | 954 | WP_257085860.1 | IS1595 family transposase | - |
| NP165_RS18240 (NP165_18240) | 1079404..1080315 | - | 912 | WP_248419187.1 | toll/interleukin-1 receptor domain-containing protein | - |
| NP165_RS18245 (NP165_18245) | 1080580..1080972 | + | 393 | WP_257085886.1 | hypothetical protein | - |
| NP165_RS18250 (NP165_18250) | 1081115..1081399 | - | 285 | WP_257085885.1 | hypothetical protein | - |
| NP165_RS18255 (NP165_18255) | 1082068..1082382 | - | 315 | WP_140139434.1 | DNA-binding transcriptional regulator | Antitoxin |
| NP165_RS18260 (NP165_18260) | 1082369..1082701 | - | 333 | WP_140139435.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NP165_RS18265 (NP165_18265) | 1083497..1083709 | - | 213 | WP_025553613.1 | hypothetical protein | - |
| NP165_RS18270 (NP165_18270) | 1083971..1084924 | + | 954 | WP_257085860.1 | IS1595 family transposase | - |
| NP165_RS18275 (NP165_18275) | 1085433..1085930 | - | 498 | WP_011080392.1 | GNAT family N-acetyltransferase | - |
| NP165_RS18280 (NP165_18280) | 1085927..1086199 | - | 273 | WP_257085896.1 | DUF1778 domain-containing protein | - |
| NP165_RS18285 (NP165_18285) | 1086373..1087332 | + | 960 | WP_257085897.1 | IS1595 family transposase | - |
| NP165_RS18290 (NP165_18290) | 1087350..1087610 | + | 261 | WP_257085898.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1078109..1091425 | 13316 | |
| - | inside | Integron | - | - | 1009525..1078214 | 68689 | |
| - | inside | Integron | - | - | 1079284..1084924 | 5640 | |
| - | inside | Integron | - | - | 1085285..1088282 | 2997 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12893.76 Da Isoelectric Point: 10.0960
>T253193 WP_140139435.1 NZ_CP102097:c1082701-1082369 [Vibrio japonicus]
MKSVFVESTIFEKYRSEYLSDEEFRLFQAELMSNPKQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS
MKSVFVESTIFEKYRSEYLSDEEFRLFQAELMSNPKQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|