Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-couple_hipB |
Location | 1402788..1403442 | Replicon | chromosome |
Accession | NZ_CP102094 | ||
Organism | Streptococcus suis strain 12RC1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NQZ84_RS06870 | Protein ID | WP_172107642.1 |
Coordinates | 1403077..1403442 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0Z8BYX8 |
Locus tag | NQZ84_RS06865 | Protein ID | WP_044670992.1 |
Coordinates | 1402788..1403087 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ84_RS06840 (NQZ84_06840) | 1398015..1399016 | - | 1002 | WP_024408714.1 | peptidylprolyl isomerase PrsA | - |
NQZ84_RS06845 (NQZ84_06845) | 1399078..1399797 | - | 720 | WP_044671062.1 | O-methyltransferase | - |
NQZ84_RS06850 (NQZ84_06850) | 1399872..1400420 | - | 549 | WP_024385841.1 | hypothetical protein | - |
NQZ84_RS06855 (NQZ84_06855) | 1400431..1400874 | - | 444 | WP_014637769.1 | hypothetical protein | - |
NQZ84_RS06860 (NQZ84_06860) | 1400876..1402678 | - | 1803 | WP_074414178.1 | oligoendopeptidase F | - |
NQZ84_RS06865 (NQZ84_06865) | 1402788..1403087 | - | 300 | WP_044670992.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NQZ84_RS06870 (NQZ84_06870) | 1403077..1403442 | - | 366 | WP_172107642.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQZ84_RS06875 (NQZ84_06875) | 1403486..1404439 | - | 954 | WP_257048379.1 | competence protein CoiA family protein | - |
NQZ84_RS06880 (NQZ84_06880) | 1404500..1406503 | - | 2004 | WP_257048381.1 | methionine--tRNA ligase | - |
NQZ84_RS06885 (NQZ84_06885) | 1406616..1407008 | - | 393 | WP_257048383.1 | hypothetical protein | - |
NQZ84_RS06890 (NQZ84_06890) | 1407091..1407231 | + | 141 | WP_257048385.1 | hypothetical protein | - |
NQZ84_RS06895 (NQZ84_06895) | 1407207..1407656 | - | 450 | WP_257048387.1 | hypothetical protein | - |
NQZ84_RS06900 (NQZ84_06900) | 1407710..1408330 | - | 621 | WP_257048389.1 | DUF3885 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14449.69 Da Isoelectric Point: 10.1354
>T253183 WP_172107642.1 NZ_CP102094:c1403442-1403077 [Streptococcus suis]
MYTIYFYKDKNGREPVLEYLRELASKKGKDSRIKLNKINDYIELLSQLGTQIGEPYVKHLEGNIWELRPLRDRILFVAWY
EGSFVLLHHFVKRSQKTPRRELEKAQRELADLKERGINNGK
MYTIYFYKDKNGREPVLEYLRELASKKGKDSRIKLNKINDYIELLSQLGTQIGEPYVKHLEGNIWELRPLRDRILFVAWY
EGSFVLLHHFVKRSQKTPRRELEKAQRELADLKERGINNGK
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|