Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 1027009..1027171 | Replicon | chromosome |
| Accession | NZ_CP102089 | ||
| Organism | Staphylococcus capitis subsp. capitis strain H17 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A507SQ11 |
| Locus tag | NF392_RS04930 | Protein ID | WP_030063529.1 |
| Coordinates | 1027009..1027113 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1027141..1027171 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF392_RS04920 | 1022941..1025880 | + | 2940 | WP_049326519.1 | AAA family ATPase | - |
| NF392_RS04925 | 1025877..1026818 | + | 942 | WP_002434737.1 | 3'-5' exoribonuclease YhaM | - |
| NF392_RS04930 | 1027009..1027113 | + | 105 | WP_030063529.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 1027141..1027171 | + | 31 | - | - | Antitoxin |
| NF392_RS04935 | 1027268..1028269 | - | 1002 | WP_023350053.1 | peptidylprolyl isomerase | - |
| NF392_RS04940 | 1028471..1029040 | - | 570 | WP_002434864.1 | DUF3267 domain-containing protein | - |
| NF392_RS04945 | 1029232..1029603 | - | 372 | WP_002434824.1 | YtxH domain-containing protein | - |
| NF392_RS04950 | 1029681..1030106 | - | 426 | WP_002434751.1 | HIT family protein | - |
| NF392_RS04955 | 1030239..1030979 | + | 741 | WP_002453567.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3963.74 Da Isoelectric Point: 10.7588
>T253178 WP_030063529.1 NZ_CP102089:1027009-1027113 [Staphylococcus capitis subsp. capitis]
MLFDIFVHIMATATSGCIVALFAHWLRTRNDKRK
MLFDIFVHIMATATSGCIVALFAHWLRTRNDKRK
Download Length: 105 bp
Antitoxin
Download Length: 31 bp
>AT253178 NZ_CP102089:1027141-1027171 [Staphylococcus capitis subsp. capitis]
AAATCCCCTCACTACTGCCATAGTGAGGGGA
AAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|