Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 295279..295798 | Replicon | chromosome |
Accession | NZ_CP102089 | ||
Organism | Staphylococcus capitis subsp. capitis strain H17 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | NF392_RS01200 | Protein ID | WP_023351018.1 |
Coordinates | 295279..295548 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | NF392_RS01205 | Protein ID | WP_023351019.1 |
Coordinates | 295541..295798 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF392_RS12060 | 290994..292145 | + | 1152 | Protein_233 | LPXTG cell wall anchor domain-containing protein | - |
NF392_RS01185 | 292259..293017 | + | 759 | WP_002454143.1 | alpha/beta hydrolase family protein | - |
NF392_RS01190 | 293558..294706 | + | 1149 | WP_171817094.1 | CapA family protein | - |
NF392_RS01195 | 294770..295135 | - | 366 | WP_002436243.1 | DUF4870 domain-containing protein | - |
NF392_RS01200 | 295279..295548 | - | 270 | WP_023351018.1 | Txe/YoeB family addiction module toxin | Toxin |
NF392_RS01205 | 295541..295798 | - | 258 | WP_023351019.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NF392_RS01210 | 295983..296840 | + | 858 | WP_023351020.1 | ABC transporter substrate-binding protein | - |
NF392_RS01215 | 296955..298595 | - | 1641 | WP_260832860.1 | alpha-keto acid decarboxylase family protein | - |
NF392_RS01220 | 298768..299223 | + | 456 | WP_002436214.1 | MarR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10500.96 Da Isoelectric Point: 9.7884
>T253174 WP_023351018.1 NZ_CP102089:c295548-295279 [Staphylococcus capitis subsp. capitis]
MSKFSVAFTAQAFKDYQYWQQHNQNYFKKVNSLLKSIARDGCVDGIGKPEALKGNYEGYFSRRVSIEQRLIYKIKDDSIF
VVSCRFHYQ
MSKFSVAFTAQAFKDYQYWQQHNQNYFKKVNSLLKSIARDGCVDGIGKPEALKGNYEGYFSRRVSIEQRLIYKIKDDSIF
VVSCRFHYQ
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|