Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 332245..332831 Replicon chromosome
Accession NZ_CP102077
Organism Klebsiella pneumoniae strain 5589

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NOV87_RS01535 Protein ID WP_002920800.1
Coordinates 332463..332831 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NOV87_RS01530 Protein ID WP_004174006.1
Coordinates 332245..332466 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOV87_RS01510 (328402) 328402..329328 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NOV87_RS01515 (329325) 329325..330602 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NOV87_RS01520 (330599) 330599..331366 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NOV87_RS01525 (331368) 331368..332081 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NOV87_RS01530 (332245) 332245..332466 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NOV87_RS01535 (332463) 332463..332831 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NOV87_RS01540 (333104) 333104..334420 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NOV87_RS01545 (334527) 334527..335414 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NOV87_RS01550 (335411) 335411..336256 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NOV87_RS01555 (336258) 336258..337328 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 329325..338065 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T253141 WP_002920800.1 NZ_CP102077:332463-332831 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT253141 WP_004174006.1 NZ_CP102077:332245-332466 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References