Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2793208..2793544 | Replicon | chromosome |
Accession | NZ_CP102070 | ||
Organism | Enterococcus faecalis strain JF3A-4253 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A1J6YG70 |
Locus tag | NP948_RS13710 | Protein ID | WP_002396786.1 |
Coordinates | 2793208..2793351 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2793495..2793544 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP948_RS13690 (2788388) | 2788388..2788603 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
NP948_RS13695 (2788742) | 2788742..2789734 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
NP948_RS13700 (2789998) | 2789998..2790636 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
NP948_RS13705 (2791322) | 2791322..2792938 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
- (2793022) | 2793022..2793097 | - | 76 | NuclAT_7 | - | - |
- (2792995) | 2792995..2793111 | - | 117 | NuclAT_10 | - | - |
NP948_RS13710 (2793208) | 2793208..2793351 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
- (2793495) | 2793495..2793544 | + | 50 | NuclAT_8 | - | Antitoxin |
- (2793283) | 2793283..2793545 | - | 263 | NuclAT_4 | - | - |
NP948_RS13715 (2793546) | 2793546..2798237 | - | 4692 | WP_104806892.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T253136 WP_002396786.1 NZ_CP102070:2793208-2793351 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT253136 NZ_CP102070:2793495-2793544 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|