Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2708518..2708780 | Replicon | chromosome |
| Accession | NZ_CP102070 | ||
| Organism | Enterococcus faecalis strain JF3A-4253 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | NP948_RS13320 | Protein ID | WP_002392696.1 |
| Coordinates | 2708637..2708780 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2708518..2708663 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP948_RS13305 (2703885) | 2703885..2704598 | - | 714 | WP_016627522.1 | trehalose operon repressor | - |
| NP948_RS13310 (2704860) | 2704860..2707604 | + | 2745 | WP_016627523.1 | glycosyl hydrolase family 65 protein | - |
| NP948_RS13315 (2707619) | 2707619..2708269 | + | 651 | WP_002367457.1 | beta-phosphoglucomutase | - |
| - (2708338) | 2708338..2708471 | + | 134 | NuclAT_6 | - | - |
| - (2708518) | 2708518..2708663 | + | 146 | NuclAT_5 | - | Antitoxin |
| - (2708518) | 2708518..2708704 | + | 187 | NuclAT_9 | - | - |
| NP948_RS13320 (2708637) | 2708637..2708780 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| NP948_RS13325 (2709188) | 2709188..2709313 | - | 126 | WP_002383214.1 | hypothetical protein | - |
| NP948_RS13330 (2709518) | 2709518..2709724 | + | 207 | WP_256969010.1 | CPBP family intramembrane metalloprotease | - |
| NP948_RS13335 (2709778) | 2709778..2710749 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| NP948_RS13340 (2710924) | 2710924..2711361 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| NP948_RS13345 (2711494) | 2711494..2712048 | - | 555 | WP_002378827.1 | nucleoside triphosphate pyrophosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T253128 WP_002392696.1 NZ_CP102070:c2708780-2708637 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 146 bp
>AT253128 NZ_CP102070:2708518-2708663 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|