Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 305996..306190 | Replicon | chromosome |
| Accession | NZ_CP102070 | ||
| Organism | Enterococcus faecalis strain JF3A-4253 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | NP948_RS01530 | Protein ID | WP_015543884.1 |
| Coordinates | 306095..306190 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 305996..306060 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP948_RS01515 (301614) | 301614..303356 | + | 1743 | WP_016627729.1 | PTS transporter subunit EIIC | - |
| NP948_RS01520 (303347) | 303347..305380 | + | 2034 | WP_256968952.1 | BglG family transcription antiterminator | - |
| NP948_RS01525 (305391) | 305391..305825 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - (305996) | 305996..306060 | + | 65 | NuclAT_12 | - | Antitoxin |
| NP948_RS01530 (306095) | 306095..306190 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NP948_RS01535 (306436) | 306436..308208 | + | 1773 | WP_010819728.1 | PTS mannitol-specific transporter subunit IIBC | - |
| NP948_RS01540 (308223) | 308223..308660 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| NP948_RS01545 (308675) | 308675..309829 | + | 1155 | WP_016627726.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| NP948_RS01550 (309897) | 309897..311012 | - | 1116 | WP_016627725.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T253120 WP_015543884.1 NZ_CP102070:c306190-306095 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT253120 NZ_CP102070:305996-306060 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|