Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2697945..2698281 | Replicon | chromosome |
Accession | NZ_CP102065 | ||
Organism | Enterococcus faecalis strain JF3A-223 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A1J6YG70 |
Locus tag | NP947_RS13155 | Protein ID | WP_002396786.1 |
Coordinates | 2697945..2698088 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2698232..2698281 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP947_RS13135 | 2693223..2693438 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
NP947_RS13140 | 2693577..2694569 | + | 993 | WP_002394775.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
NP947_RS13145 | 2694736..2695374 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
NP947_RS13150 | 2696059..2697675 | + | 1617 | WP_010710855.1 | phosphatase PAP2/LCP family protein | - |
NP947_RS13155 | 2697945..2698088 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
- | 2698232..2698281 | + | 50 | - | - | Antitoxin |
NP947_RS13160 | 2698283..2702974 | - | 4692 | WP_010710853.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T253116 WP_002396786.1 NZ_CP102065:2697945-2698088 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT253116 NZ_CP102065:2698232-2698281 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|