Detailed information of TA system TA253099

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 125783..126209
• Replicon: plasmid pMDR31
• Accession: NZ_CP102062
• Organism: Escherichia coli strain C31

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NP943_RS25940
• Protein ID: WP_001372321.1
• Coordinates: 125783..125908 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	125985..126209 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NP943_RS25900 (120821)	120821..121048	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
NP943_RS25905 (121142)	121142..121828	-	687	WP_000332487.1	PAS domain-containing protein	-
NP943_RS25910 (122022)	122022..122405	-	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NP943_RS25915 (122691)	122691..123338	+	648	WP_000614282.1	transglycosylase SLT domain-containing protein	-
NP943_RS25920 (123635)	123635..124456	-	822	WP_001234469.1	DUF932 domain-containing protein	-
NP943_RS25925 (124577)	124577..124864	-	288	WP_000107537.1	hypothetical protein	-
NP943_RS25930 (125162)	125162..125335	+	174	Protein_130	hypothetical protein	-
NP943_RS25935 (125333)	125333..125563	-	231	WP_071587244.1	hypothetical protein	-
NP943_RS25940 (125783)	125783..125908	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NP943_RS25945 (125850)	125850..125999	-	150	Protein_133	plasmid maintenance protein Mok	-
- (125985)	125985..126209	-	225	NuclAT_0	-	Antitoxin
- (125985)	125985..126209	-	225	NuclAT_0	-	Antitoxin
- (125985)	125985..126209	-	225	NuclAT_0	-	Antitoxin
- (125985)	125985..126209	-	225	NuclAT_0	-	Antitoxin
NP943_RS25950 (126021)	126021..126209	+	189	WP_001299721.1	hypothetical protein	-
NP943_RS25955 (126178)	126178..126940	-	763	Protein_135	plasmid SOS inhibition protein A	-
NP943_RS25960 (126937)	126937..127371	-	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
NP943_RS25965 (127426)	127426..129384	-	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
NP943_RS25970 (129443)	129443..129676	-	234	WP_000006004.1	DUF905 domain-containing protein	-
NP943_RS25975 (129732)	129732..130259	-	528	WP_000290793.1	single-stranded DNA-binding protein	-
NP943_RS25980 (130729)	130729..131007	-	279	WP_001371319.1	hypothetical protein	-
NP943_RS25985 (130899)	130899..131159	-	261	WP_021536188.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T253099 WP_001372321.1 NZ_CP102062:c125908-125783 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT253099 NZ_CP102062:c126209-125985 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin