Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5064941..5065162 Replicon chromosome
Accession NZ_CP102061
Organism Escherichia coli strain C31

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag NP943_RS24835 Protein ID WP_001531632.1
Coordinates 5064941..5065048 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5065096..5065162 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP943_RS24810 (5060785) 5060785..5061867 + 1083 WP_000804726.1 peptide chain release factor 1 -
NP943_RS24815 (5061867) 5061867..5062700 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
NP943_RS24820 (5062697) 5062697..5063089 + 393 WP_000200375.1 invasion regulator SirB2 -
NP943_RS24825 (5063093) 5063093..5063902 + 810 WP_001257044.1 invasion regulator SirB1 -
NP943_RS24830 (5063938) 5063938..5064792 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
NP943_RS24835 (5064941) 5064941..5065048 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5065098) 5065098..5065161 + 64 NuclAT_12 - -
- (5065098) 5065098..5065161 + 64 NuclAT_12 - -
- (5065098) 5065098..5065161 + 64 NuclAT_12 - -
- (5065098) 5065098..5065161 + 64 NuclAT_12 - -
- (5065098) 5065098..5065161 + 64 NuclAT_13 - -
- (5065098) 5065098..5065161 + 64 NuclAT_13 - -
- (5065098) 5065098..5065161 + 64 NuclAT_13 - -
- (5065098) 5065098..5065161 + 64 NuclAT_13 - -
- (5065098) 5065098..5065161 + 64 NuclAT_14 - -
- (5065098) 5065098..5065161 + 64 NuclAT_14 - -
- (5065098) 5065098..5065161 + 64 NuclAT_14 - -
- (5065098) 5065098..5065161 + 64 NuclAT_14 - -
- (5065098) 5065098..5065161 + 64 NuclAT_15 - -
- (5065098) 5065098..5065161 + 64 NuclAT_15 - -
- (5065098) 5065098..5065161 + 64 NuclAT_15 - -
- (5065098) 5065098..5065161 + 64 NuclAT_15 - -
- (5065098) 5065098..5065161 + 64 NuclAT_16 - -
- (5065098) 5065098..5065161 + 64 NuclAT_16 - -
- (5065098) 5065098..5065161 + 64 NuclAT_16 - -
- (5065098) 5065098..5065161 + 64 NuclAT_16 - -
- (5065098) 5065098..5065161 + 64 NuclAT_17 - -
- (5065098) 5065098..5065161 + 64 NuclAT_17 - -
- (5065098) 5065098..5065161 + 64 NuclAT_17 - -
- (5065098) 5065098..5065161 + 64 NuclAT_17 - -
- (5065096) 5065096..5065162 + 67 NuclAT_10 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_10 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_10 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_10 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_5 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_5 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_5 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_5 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_6 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_6 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_6 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_6 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_7 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_7 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_7 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_7 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_8 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_8 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_8 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_8 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_9 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_9 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_9 - Antitoxin
- (5065096) 5065096..5065162 + 67 NuclAT_9 - Antitoxin
- (5065098) 5065098..5065163 + 66 NuclAT_18 - -
- (5065098) 5065098..5065163 + 66 NuclAT_18 - -
- (5065098) 5065098..5065163 + 66 NuclAT_18 - -
- (5065098) 5065098..5065163 + 66 NuclAT_18 - -
- (5065098) 5065098..5065163 + 66 NuclAT_19 - -
- (5065098) 5065098..5065163 + 66 NuclAT_19 - -
- (5065098) 5065098..5065163 + 66 NuclAT_19 - -
- (5065098) 5065098..5065163 + 66 NuclAT_19 - -
- (5065098) 5065098..5065163 + 66 NuclAT_20 - -
- (5065098) 5065098..5065163 + 66 NuclAT_20 - -
- (5065098) 5065098..5065163 + 66 NuclAT_20 - -
- (5065098) 5065098..5065163 + 66 NuclAT_20 - -
- (5065098) 5065098..5065163 + 66 NuclAT_21 - -
- (5065098) 5065098..5065163 + 66 NuclAT_21 - -
- (5065098) 5065098..5065163 + 66 NuclAT_21 - -
- (5065098) 5065098..5065163 + 66 NuclAT_21 - -
- (5065098) 5065098..5065163 + 66 NuclAT_22 - -
- (5065098) 5065098..5065163 + 66 NuclAT_22 - -
- (5065098) 5065098..5065163 + 66 NuclAT_22 - -
- (5065098) 5065098..5065163 + 66 NuclAT_22 - -
- (5065098) 5065098..5065163 + 66 NuclAT_23 - -
- (5065098) 5065098..5065163 + 66 NuclAT_23 - -
- (5065098) 5065098..5065163 + 66 NuclAT_23 - -
- (5065098) 5065098..5065163 + 66 NuclAT_23 - -
NP943_RS24840 (5065453) 5065453..5066553 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
NP943_RS24845 (5066823) 5066823..5067062 + 240 WP_000120702.1 putative cation transport regulator ChaB -
NP943_RS24850 (5067211) 5067211..5067906 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
NP943_RS24855 (5067950) 5067950..5068303 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
NP943_RS24860 (5068488) 5068488..5069882 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T253095 WP_001531632.1 NZ_CP102061:c5065048-5064941 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT253095 NZ_CP102061:5065096-5065162 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References