Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 4215997..4216676 | Replicon | chromosome |
Accession | NZ_CP102061 | ||
Organism | Escherichia coli strain C31 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | NP943_RS20460 | Protein ID | WP_000057523.1 |
Coordinates | 4215997..4216299 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | NP943_RS20465 | Protein ID | WP_000806442.1 |
Coordinates | 4216335..4216676 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP943_RS20435 (4211373) | 4211373..4213025 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
NP943_RS20440 (4213063) | 4213063..4213566 | - | 504 | WP_000667000.1 | hypothetical protein | - |
NP943_RS20445 (4213563) | 4213563..4214363 | - | 801 | WP_000439798.1 | hypothetical protein | - |
NP943_RS20450 (4214387) | 4214387..4214866 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
NP943_RS20455 (4215070) | 4215070..4215864 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
NP943_RS20460 (4215997) | 4215997..4216299 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP943_RS20465 (4216335) | 4216335..4216676 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
NP943_RS20470 (4216734) | 4216734..4219238 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
NP943_RS20475 (4219500) | 4219500..4220432 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T253094 WP_000057523.1 NZ_CP102061:4215997-4216299 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|