Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3004109..3004711 | Replicon | chromosome |
| Accession | NZ_CP102061 | ||
| Organism | Escherichia coli strain C31 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | NP943_RS14615 | Protein ID | WP_000897302.1 |
| Coordinates | 3004109..3004420 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NP943_RS14620 | Protein ID | WP_000356397.1 |
| Coordinates | 3004421..3004711 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP943_RS14590 (3000023) | 3000023..3000622 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| NP943_RS14595 (3000616) | 3000616..3001488 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NP943_RS14600 (3001485) | 3001485..3001922 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| NP943_RS14605 (3001967) | 3001967..3002908 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NP943_RS14610 (3002972) | 3002972..3003880 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| NP943_RS14615 (3004109) | 3004109..3004420 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| NP943_RS14620 (3004421) | 3004421..3004711 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NP943_RS14625 (3005070) | 3005070..3005348 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| NP943_RS14630 (3005745) | 3005745..3005963 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| NP943_RS14635 (3006148) | 3006148..3006888 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| NP943_RS14640 (3006913) | 3006913..3007761 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| NP943_RS14645 (3008051) | 3008051..3008293 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| NP943_RS14650 (3008475) | 3008475..3009404 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T253086 WP_000897302.1 NZ_CP102061:3004109-3004420 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|