Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2154575..2155374 | Replicon | chromosome |
Accession | NZ_CP102061 | ||
Organism | Escherichia coli strain C31 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | NP943_RS10495 | Protein ID | WP_000347251.1 |
Coordinates | 2154910..2155374 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | NP943_RS10490 | Protein ID | WP_001296435.1 |
Coordinates | 2154575..2154910 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP943_RS10475 (2150360) | 2150360..2151130 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NP943_RS10480 (2151146) | 2151146..2152480 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
NP943_RS10485 (2152855) | 2152855..2154426 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
NP943_RS10490 (2154575) | 2154575..2154910 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NP943_RS10495 (2154910) | 2154910..2155374 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NP943_RS10500 (2155429) | 2155429..2156238 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NP943_RS10505 (2156487) | 2156487..2157767 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NP943_RS10510 (2157790) | 2157790..2158263 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NP943_RS10515 (2158274) | 2158274..2159053 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NP943_RS10520 (2159043) | 2159043..2159921 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NP943_RS10525 (2159939) | 2159939..2160373 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T253084 WP_000347251.1 NZ_CP102061:2154910-2155374 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |