Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
| Location | 3483802..3484340 | Replicon | chromosome |
| Accession | NZ_CP101940 | ||
| Organism | Salmonella enterica subsp. enterica strain QA-1986 974 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | A0A7U1Q7V6 |
| Locus tag | NP448_RS17070 | Protein ID | WP_001521736.1 |
| Coordinates | 3484065..3484340 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | A0A7U1KUN1 |
| Locus tag | NP448_RS17065 | Protein ID | WP_000729714.1 |
| Coordinates | 3483802..3484062 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP448_RS17050 (3479557) | 3479557..3481110 | + | 1554 | WP_058653096.1 | TROVE domain-containing protein | - |
| NP448_RS17055 (3481456) | 3481456..3482670 | + | 1215 | WP_001105525.1 | RNA-splicing ligase RtcB | - |
| NP448_RS17060 (3482674) | 3482674..3483693 | + | 1020 | WP_000101027.1 | RNA 3'-terminal phosphate cyclase | - |
| NP448_RS17065 (3483802) | 3483802..3484062 | + | 261 | WP_000729714.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NP448_RS17070 (3484065) | 3484065..3484340 | + | 276 | WP_001521736.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| NP448_RS17075 (3484428) | 3484428..3487133 | - | 2706 | WP_000907030.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10618.25 Da Isoelectric Point: 9.7714
>T253051 WP_001521736.1 NZ_CP101940:3484065-3484340 [Salmonella enterica subsp. enterica]
MGQRKIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
MGQRKIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U1Q7V6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U1KUN1 |