Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2930131..2930885 | Replicon | chromosome |
Accession | NZ_CP101940 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 974 |
Toxin (Protein)
Gene name | higB | Uniprot ID | B5F003 |
Locus tag | NP448_RS14470 | Protein ID | WP_000558166.1 |
Coordinates | 2930131..2930442 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NP448_RS14475 | Protein ID | WP_001259011.1 |
Coordinates | 2930439..2930885 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP448_RS14440 (2925789) | 2925789..2926691 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
NP448_RS14445 (2926688) | 2926688..2927323 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NP448_RS14450 (2927320) | 2927320..2928249 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
NP448_RS14455 (2928296) | 2928296..2928586 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
NP448_RS14460 (2928587) | 2928587..2928898 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
NP448_RS14465 (2929116) | 2929116..2930045 | + | 930 | WP_001127704.1 | alpha/beta hydrolase | - |
NP448_RS14470 (2930131) | 2930131..2930442 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NP448_RS14475 (2930439) | 2930439..2930885 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
NP448_RS14480 (2930900) | 2930900..2931841 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NP448_RS14485 (2931886) | 2931886..2932323 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
NP448_RS14490 (2932320) | 2932320..2933192 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
NP448_RS14495 (2933186) | 2933186..2933785 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
NP448_RS14500 (2933976) | 2933976..2934779 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NP448_RS14505 (2934813) | 2934813..2935709 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T253049 WP_000558166.1 NZ_CP101940:2930131-2930442 [Salmonella enterica subsp. enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT253049 WP_001259011.1 NZ_CP101940:2930439-2930885 [Salmonella enterica subsp. enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|