Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 633290..633812 | Replicon | chromosome |
Accession | NZ_CP101940 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 974 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | NP448_RS03260 | Protein ID | WP_000221345.1 |
Coordinates | 633528..633812 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NP448_RS03255 | Protein ID | WP_000885424.1 |
Coordinates | 633290..633538 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP448_RS03230 (628506) | 628506..629972 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NP448_RS03235 (630780) | 630780..631494 | + | 715 | Protein_631 | helix-turn-helix domain-containing protein | - |
NP448_RS03240 (631550) | 631550..632458 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NP448_RS03245 (632601) | 632601..632933 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NP448_RS03250 (632923) | 632923..633138 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NP448_RS03255 (633290) | 633290..633538 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NP448_RS03260 (633528) | 633528..633812 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP448_RS03265 (633983) | 633983..634372 | + | 390 | WP_000194089.1 | RidA family protein | - |
NP448_RS03270 (634424) | 634424..635503 | - | 1080 | WP_058653180.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NP448_RS03275 (635685) | 635685..636173 | - | 489 | WP_001293637.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NP448_RS03280 (636218) | 636218..637726 | + | 1509 | WP_058653181.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 630254..640583 | 10329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T253042 WP_000221345.1 NZ_CP101940:633528-633812 [Salmonella enterica subsp. enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |