Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 43221..43867 | Replicon | plasmid pEcFELIX377.1 |
Accession | NZ_CP101926 | ||
Organism | Escherichia coli strain Seattle 1946 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7R6ZH56 |
Locus tag | NP429_RS25010 | Protein ID | WP_000269913.1 |
Coordinates | 43520..43867 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1V3UZT0 |
Locus tag | NP429_RS25005 | Protein ID | WP_001259436.1 |
Coordinates | 43221..43520 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP429_RS24975 (NP429_24985) | 39055..39627 | - | 573 | WP_000137931.1 | helix-turn-helix transcriptional regulator | - |
NP429_RS24980 (NP429_24990) | 40201..40392 | + | 192 | WP_000183352.1 | hypothetical protein | - |
NP429_RS24985 (NP429_24995) | 40389..41531 | + | 1143 | WP_000854799.1 | ORF6N domain-containing protein | - |
NP429_RS24990 (NP429_25000) | 41542..41730 | - | 189 | WP_000986262.1 | hypothetical protein | - |
NP429_RS24995 (NP429_25005) | 42341..42613 | - | 273 | WP_000148349.1 | helix-turn-helix domain-containing protein | - |
NP429_RS25000 (NP429_25010) | 42677..43051 | - | 375 | WP_244426537.1 | hypothetical protein | - |
NP429_RS25005 (NP429_25015) | 43221..43520 | - | 300 | WP_001259436.1 | XRE family transcriptional regulator | Antitoxin |
NP429_RS25010 (NP429_25020) | 43520..43867 | - | 348 | WP_000269913.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP429_RS25015 (NP429_25025) | 44112..44375 | - | 264 | WP_000424604.1 | hypothetical protein | - |
NP429_RS25020 (NP429_25030) | 44399..44686 | - | 288 | WP_000356589.1 | hypothetical protein | - |
NP429_RS25025 (NP429_25035) | 45330..46310 | - | 981 | WP_228465520.1 | plasmid replication initiator RepA | - |
NP429_RS25030 (NP429_25040) | 46492..47046 | - | 555 | WP_001199265.1 | recombinase family protein | - |
NP429_RS25035 (NP429_25045) | 47212..48138 | + | 927 | Protein_66 | phage tail protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..48488 | 48488 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13486.53 Da Isoelectric Point: 9.8723
>T253008 WP_000269913.1 NZ_CP101926:c43867-43520 [Escherichia coli]
MWTVLFSQRFDGWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYKKLVRIAEDEFAAHLNTLESK
MWTVLFSQRFDGWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYKKLVRIAEDEFAAHLNTLESK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7R6ZH56 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V3UZT0 |