Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4269357..4269615 | Replicon | chromosome |
| Accession | NZ_CP101925 | ||
| Organism | Escherichia coli strain Seattle 1946 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | NP429_RS20600 | Protein ID | WP_000809168.1 |
| Coordinates | 4269463..4269615 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4269357..4269414 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP429_RS20585 | 4265186..4266445 | - | 1260 | WP_000494928.1 | hypothetical protein | - |
| NP429_RS20590 | 4266574..4268067 | - | 1494 | WP_001443162.1 | sulfatase-like hydrolase/transferase | - |
| NP429_RS20595 | 4268087..4268848 | - | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
| - | 4269357..4269414 | - | 58 | - | - | Antitoxin |
| NP429_RS20600 | 4269463..4269615 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| NP429_RS20605 | 4269720..4270850 | - | 1131 | WP_001118465.1 | molecular chaperone DnaJ | - |
| NP429_RS20610 | 4270939..4272855 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| NP429_RS20615 | 4273227..4273631 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
| NP429_RS20620 | 4273657..4274370 | + | 714 | WP_001102391.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T253003 WP_000809168.1 NZ_CP101925:4269463-4269615 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT253003 NZ_CP101925:c4269414-4269357 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|