Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4033068..4033866 | Replicon | chromosome |
Accession | NZ_CP101925 | ||
Organism | Escherichia coli strain Seattle 1946 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | Q8VRA6 |
Locus tag | NP429_RS19485 | Protein ID | WP_000854730.1 |
Coordinates | 4033489..4033866 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0P0SQV8 |
Locus tag | NP429_RS19480 | Protein ID | WP_001285481.1 |
Coordinates | 4033068..4033442 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP429_RS19440 (4029043) | 4029043..4029495 | + | 453 | WP_000682723.1 | hypothetical protein | - |
NP429_RS19445 (4029613) | 4029613..4029846 | + | 234 | WP_001213776.1 | DUF905 family protein | - |
NP429_RS19450 (4029946) | 4029946..4030767 | + | 822 | WP_001234359.1 | DUF932 domain-containing protein | - |
NP429_RS19455 (4030767) | 4030767..4031012 | + | 246 | WP_001164966.1 | hypothetical protein | - |
NP429_RS19460 (4031106) | 4031106..4031579 | + | 474 | WP_001313575.1 | antirestriction protein | - |
NP429_RS19465 (4031595) | 4031595..4032071 | + | 477 | WP_001313574.1 | RadC family protein | - |
NP429_RS19470 (4032134) | 4032134..4032355 | + | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
NP429_RS19475 (4032374) | 4032374..4033018 | + | 645 | WP_000086761.1 | hypothetical protein | - |
NP429_RS19480 (4033068) | 4033068..4033442 | + | 375 | WP_001285481.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NP429_RS19485 (4033489) | 4033489..4033866 | + | 378 | WP_000854730.1 | TA system toxin CbtA family protein | Toxin |
NP429_RS19490 (4033863) | 4033863..4034355 | + | 493 | Protein_3824 | DUF5983 family protein | - |
NP429_RS19495 (4034434) | 4034434..4035422 | - | 989 | Protein_3825 | IS630 family transposase | - |
NP429_RS19500 (4035570) | 4035570..4035758 | - | 189 | Protein_3826 | IS66 family transposase | - |
NP429_RS19505 (4035819) | 4035819..4036952 | + | 1134 | WP_000555401.1 | IS110-like element ISEc45 family transposase | - |
NP429_RS19510 (4037206) | 4037206..4038610 | - | 1405 | Protein_3828 | IS66 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4033068..4043555 | 10487 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14212.21 Da Isoelectric Point: 7.2923
>T253001 WP_000854730.1 NZ_CP101925:4033489-4033866 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13817.53 Da Isoelectric Point: 4.7511
>AT253001 WP_001285481.1 NZ_CP101925:4033068-4033442 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H2V671 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P0SQV8 |