Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1931605..1932436 Replicon chromosome
Accession NZ_CP101925
Organism Escherichia coli strain Seattle 1946

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag NP429_RS09140 Protein ID WP_000854814.1
Coordinates 1931605..1931979 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1PWQ3
Locus tag NP429_RS09145 Protein ID WP_001285586.1
Coordinates 1932068..1932436 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP429_RS09105 (1927009) 1927009..1928229 + 1221 WP_001546343.1 ISL3-like element ISEc53 family transposase -
NP429_RS09110 (1928286) 1928286..1928759 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
NP429_RS09115 (1928957) 1928957..1930015 + 1059 WP_001200890.1 FUSC family protein -
NP429_RS09120 (1930187) 1930187..1930516 + 330 WP_000450409.1 DUF496 family protein -
NP429_RS09125 (1930617) 1930617..1930973 - 357 WP_000929389.1 EutP/PduV family microcompartment system protein -
NP429_RS09130 (1931288) 1931288..1931368 - 81 Protein_1787 hypothetical protein -
NP429_RS09135 (1931414) 1931414..1931608 - 195 WP_000988601.1 DUF5983 family protein -
NP429_RS09140 (1931605) 1931605..1931979 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NP429_RS09145 (1932068) 1932068..1932436 - 369 WP_001285586.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NP429_RS09150 (1932510) 1932510..1932731 - 222 WP_000692323.1 DUF987 domain-containing protein -
NP429_RS09155 (1932800) 1932800..1933276 - 477 WP_001351157.1 RadC family protein -
NP429_RS09160 (1933292) 1933292..1933777 - 486 WP_000213703.1 antirestriction protein -
NP429_RS09165 (1933868) 1933868..1934689 - 822 WP_001234569.1 DUF932 domain-containing protein -
NP429_RS09170 (1934910) 1934910..1935320 - 411 WP_000846704.1 hypothetical protein -
NP429_RS09175 (1935336) 1935336..1936013 - 678 WP_001362823.1 hypothetical protein -
NP429_RS09180 (1936149) 1936149..1937219 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 1927009..1928229 1220


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T252991 WP_000854814.1 NZ_CP101925:c1931979-1931605 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13563.41 Da        Isoelectric Point: 5.0468

>AT252991 WP_001285586.1 NZ_CP101925:c1932436-1932068 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB S1PWQ3

References