Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 697886..698579 | Replicon | chromosome |
Accession | NZ_CP101922 | ||
Organism | Escherichia coli strain JCC-EE 7 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NP442_RS03440 | Protein ID | WP_000415584.1 |
Coordinates | 697886..698182 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NP442_RS03445 | Protein ID | WP_000650107.1 |
Coordinates | 698184..698579 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP442_RS03405 (692974) | 692974..693288 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
NP442_RS03410 (693319) | 693319..693900 | - | 582 | WP_098717236.1 | NADPH:quinone oxidoreductase MdaB | - |
NP442_RS03415 (694219) | 694219..694551 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
NP442_RS03420 (694597) | 694597..695946 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
NP442_RS03425 (695943) | 695943..696602 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
NP442_RS03430 (696754) | 696754..697146 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NP442_RS03435 (697199) | 697199..697681 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NP442_RS03440 (697886) | 697886..698182 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NP442_RS03445 (698184) | 698184..698579 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NP442_RS03450 (698712) | 698712..700319 | + | 1608 | WP_001735743.1 | ABC transporter substrate-binding protein | - |
NP442_RS03455 (700457) | 700457..702715 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T252968 WP_000415584.1 NZ_CP101922:697886-698182 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT252968 WP_000650107.1 NZ_CP101922:698184-698579 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|