Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4588035..4588637 | Replicon | chromosome |
Accession | NZ_CP101921 | ||
Organism | Escherichia coli strain QA-1986 83 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NP438_RS22055 | Protein ID | WP_000897305.1 |
Coordinates | 4588326..4588637 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NP438_RS22050 | Protein ID | WP_000356397.1 |
Coordinates | 4588035..4588325 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP438_RS22025 (4583961) | 4583961..4584863 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NP438_RS22030 (4584860) | 4584860..4585495 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NP438_RS22035 (4585492) | 4585492..4586421 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NP438_RS22040 (4586751) | 4586751..4586993 | - | 243 | WP_001086388.1 | protein YiiF | - |
NP438_RS22045 (4587212) | 4587212..4587430 | - | 219 | WP_001297075.1 | CopG family transcriptional regulator | - |
NP438_RS22050 (4588035) | 4588035..4588325 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NP438_RS22055 (4588326) | 4588326..4588637 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NP438_RS22060 (4588866) | 4588866..4589774 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NP438_RS22065 (4589838) | 4589838..4590779 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NP438_RS22070 (4590824) | 4590824..4591261 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NP438_RS22075 (4591258) | 4591258..4592130 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NP438_RS22080 (4592124) | 4592124..4592723 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
NP438_RS22085 (4592822) | 4592822..4593607 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T252965 WP_000897305.1 NZ_CP101921:c4588637-4588326 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|