Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2577685..2578044 | Replicon | chromosome |
Accession | NZ_CP101921 | ||
Organism | Escherichia coli strain QA-1986 83 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | NP438_RS12435 | Protein ID | WP_001317028.1 |
Coordinates | 2577685..2577879 (+) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2577878..2578044 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP438_RS12410 (2573383) | 2573383..2573604 | + | 222 | WP_000560224.1 | killing protein KilR | - |
NP438_RS12415 (2573604) | 2573604..2573774 | + | 171 | WP_001352098.1 | YdaE family protein | - |
NP438_RS12420 (2573849) | 2573849..2574124 | + | 276 | WP_024251429.1 | hypothetical protein | - |
NP438_RS12425 (2574226) | 2574226..2576826 | + | 2601 | WP_000105136.1 | exodeoxyribonuclease VIII | - |
NP438_RS12430 (2576819) | 2576819..2577628 | + | 810 | WP_000166319.1 | recombination protein RecT | - |
NP438_RS12435 (2577685) | 2577685..2577879 | + | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
- (2577878) | 2577878..2578044 | - | 167 | NuclAT_1 | - | Antitoxin |
- (2577878) | 2577878..2578044 | - | 167 | NuclAT_1 | - | Antitoxin |
- (2577878) | 2577878..2578044 | - | 167 | NuclAT_1 | - | Antitoxin |
- (2577878) | 2577878..2578044 | - | 167 | NuclAT_1 | - | Antitoxin |
NP438_RS12440 (2577872) | 2577872..2578069 | + | 198 | WP_024170988.1 | DUF1187 family protein | - |
NP438_RS12445 (2578148) | 2578148..2578363 | + | 216 | WP_000079604.1 | excisionase XisR | - |
NP438_RS12450 (2578365) | 2578365..2579600 | + | 1236 | WP_000040852.1 | site-specific integrase | - |
NP438_RS12455 (2579652) | 2579652..2580587 | + | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
NP438_RS12460 (2580716) | 2580716..2582089 | - | 1374 | WP_000123739.1 | ATP-dependent RNA helicase DbpA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2530502..2579600 | 49098 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T252957 WP_001317028.1 NZ_CP101921:2577685-2577879 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 167 bp
>AT252957 NZ_CP101921:c2578044-2577878 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAATTTTACCTGAGAGCATTTTTTC
GCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTTCAATAGTGGCGG
TAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAATTTTACCTGAGAGCATTTTTTC
GCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTTCAATAGTGGCGG
TAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|