Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 593693..594492 | Replicon | chromosome |
| Accession | NZ_CP101921 | ||
| Organism | Escherichia coli strain QA-1986 83 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | NP438_RS02895 | Protein ID | WP_000347253.1 |
| Coordinates | 593693..594157 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | NP438_RS02900 | Protein ID | WP_024251361.1 |
| Coordinates | 594157..594492 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP438_RS02865 (588694) | 588694..589128 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NP438_RS02870 (589146) | 589146..590024 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NP438_RS02875 (590014) | 590014..590793 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NP438_RS02880 (590804) | 590804..591277 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NP438_RS02885 (591300) | 591300..592580 | - | 1281 | WP_000681910.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NP438_RS02890 (592829) | 592829..593638 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NP438_RS02895 (593693) | 593693..594157 | - | 465 | WP_000347253.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NP438_RS02900 (594157) | 594157..594492 | - | 336 | WP_024251361.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NP438_RS02905 (594641) | 594641..596212 | - | 1572 | WP_001273766.1 | galactarate dehydratase | - |
| NP438_RS02910 (596587) | 596587..597921 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NP438_RS02915 (597937) | 597937..598707 | + | 771 | WP_001058226.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17764.14 Da Isoelectric Point: 9.4947
>T252945 WP_000347253.1 NZ_CP101921:c594157-593693 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|