Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4870871..4871473 | Replicon | chromosome |
| Accession | NZ_CP101920 | ||
| Organism | Escherichia coli strain QA-1986 630 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NP447_RS23755 | Protein ID | WP_000897305.1 |
| Coordinates | 4871162..4871473 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NP447_RS23750 | Protein ID | WP_000356397.1 |
| Coordinates | 4870871..4871161 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP447_RS23725 (4866796) | 4866796..4867698 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NP447_RS23730 (4867695) | 4867695..4868330 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NP447_RS23735 (4868327) | 4868327..4869256 | + | 930 | WP_000027707.1 | formate dehydrogenase accessory protein FdhE | - |
| NP447_RS23740 (4869586) | 4869586..4869828 | - | 243 | WP_001087409.1 | protein YiiF | - |
| NP447_RS23745 (4870048) | 4870048..4870266 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| NP447_RS23750 (4870871) | 4870871..4871161 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NP447_RS23755 (4871162) | 4871162..4871473 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NP447_RS23760 (4871702) | 4871702..4872610 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| NP447_RS23765 (4872674) | 4872674..4873615 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NP447_RS23770 (4873660) | 4873660..4874097 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| NP447_RS23775 (4874094) | 4874094..4874966 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NP447_RS23780 (4874960) | 4874960..4875559 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T252943 WP_000897305.1 NZ_CP101920:c4871473-4871162 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|