Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3680036..3680715 | Replicon | chromosome |
Accession | NZ_CP101920 | ||
Organism | Escherichia coli strain QA-1986 630 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XN95 |
Locus tag | NP447_RS17995 | Protein ID | WP_000057540.1 |
Coordinates | 3680413..3680715 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | NP447_RS17990 | Protein ID | WP_000806442.1 |
Coordinates | 3680036..3680377 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP447_RS17980 (3676280) | 3676280..3677212 | - | 933 | WP_023155692.1 | glutaminase A | - |
NP447_RS17985 (3677474) | 3677474..3679978 | + | 2505 | WP_000083962.1 | copper-exporting P-type ATPase CopA | - |
NP447_RS17990 (3680036) | 3680036..3680377 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
NP447_RS17995 (3680413) | 3680413..3680715 | - | 303 | WP_000057540.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP447_RS18000 (3680848) | 3680848..3681642 | + | 795 | WP_000365180.1 | TraB/GumN family protein | - |
NP447_RS18005 (3681846) | 3681846..3682325 | + | 480 | WP_000186631.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
NP447_RS18010 (3682362) | 3682362..3684014 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
NP447_RS18015 (3684232) | 3684232..3685452 | + | 1221 | WP_001251608.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11781.35 Da Isoelectric Point: 10.2638
>T252939 WP_000057540.1 NZ_CP101920:c3680715-3680413 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTSLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTSLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|