Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3649680..3650374 | Replicon | chromosome |
Accession | NZ_CP101915 | ||
Organism | Escherichia coli strain Evo1 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | NP443_RS17780 | Protein ID | WP_001263489.1 |
Coordinates | 3649680..3650078 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | NP443_RS17785 | Protein ID | WP_000554758.1 |
Coordinates | 3650081..3650374 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3645268) | 3645268..3645348 | - | 81 | NuclAT_10 | - | - |
- (3645268) | 3645268..3645348 | - | 81 | NuclAT_10 | - | - |
- (3645268) | 3645268..3645348 | - | 81 | NuclAT_10 | - | - |
- (3645268) | 3645268..3645348 | - | 81 | NuclAT_10 | - | - |
NP443_RS17755 (3645944) | 3645944..3646402 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
NP443_RS17760 (3646663) | 3646663..3648120 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
NP443_RS17765 (3648177) | 3648177..3648698 | - | 522 | Protein_3474 | peptide chain release factor H | - |
NP443_RS17770 (3648694) | 3648694..3648900 | - | 207 | Protein_3475 | RtcB family protein | - |
NP443_RS17775 (3649218) | 3649218..3649670 | - | 453 | WP_074514769.1 | GNAT family N-acetyltransferase | - |
NP443_RS17780 (3649680) | 3649680..3650078 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NP443_RS17785 (3650081) | 3650081..3650374 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NP443_RS17790 (3650426) | 3650426..3651481 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NP443_RS17795 (3651552) | 3651552..3652337 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NP443_RS17800 (3652309) | 3652309..3654021 | + | 1713 | Protein_3481 | flagellar biosynthesis protein FlhA | - |
NP443_RS17805 (3654245) | 3654245..3654742 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3649680..3664960 | 15280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T252918 WP_001263489.1 NZ_CP101915:c3650078-3649680 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |