Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 599058..599857 | Replicon | chromosome |
Accession | NZ_CP101915 | ||
Organism | Escherichia coli strain Evo1 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | NP443_RS02940 | Protein ID | WP_000347273.1 |
Coordinates | 599058..599522 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NP443_RS02945 | Protein ID | WP_001307405.1 |
Coordinates | 599522..599857 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP443_RS02910 (594059) | 594059..594493 | - | 435 | WP_032182759.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NP443_RS02915 (594511) | 594511..595389 | - | 879 | WP_001300474.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NP443_RS02920 (595379) | 595379..596158 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NP443_RS02925 (596169) | 596169..596642 | - | 474 | WP_024229000.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NP443_RS02930 (596665) | 596665..597945 | - | 1281 | WP_074514777.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NP443_RS02935 (598194) | 598194..599003 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NP443_RS02940 (599058) | 599058..599522 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NP443_RS02945 (599522) | 599522..599857 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NP443_RS02950 (600006) | 600006..601577 | - | 1572 | WP_074514537.1 | galactarate dehydratase | - |
NP443_RS02955 (601952) | 601952..603286 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NP443_RS02960 (603302) | 603302..604072 | + | 771 | WP_073461569.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T252905 WP_000347273.1 NZ_CP101915:c599522-599058 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |