Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5801751..5802346 | Replicon | chromosome |
| Accession | NZ_CP101912 | ||
| Organism | Pseudomonas aeruginosa strain ATCC 27853 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | NP446_RS27485 | Protein ID | WP_003117425.1 |
| Coordinates | 5802068..5802346 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NP446_RS27480 | Protein ID | WP_003099268.1 |
| Coordinates | 5801751..5802056 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP446_RS27450 (NP446_27450) | 5797204..5797494 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
| NP446_RS27455 (NP446_27455) | 5797706..5797978 | - | 273 | WP_003115921.1 | hypothetical protein | - |
| NP446_RS27460 (NP446_27460) | 5798088..5798354 | + | 267 | WP_016852153.1 | hypothetical protein | - |
| NP446_RS27465 (NP446_27465) | 5798486..5799322 | + | 837 | WP_223656480.1 | helix-turn-helix domain-containing protein | - |
| NP446_RS27470 (NP446_27470) | 5799297..5800835 | + | 1539 | WP_023082696.1 | GNAT family N-acetyltransferase | - |
| NP446_RS27475 (NP446_27475) | 5800847..5801374 | - | 528 | WP_071535723.1 | ATP-binding protein | - |
| NP446_RS27480 (NP446_27480) | 5801751..5802056 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| NP446_RS27485 (NP446_27485) | 5802068..5802346 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NP446_RS27490 (NP446_27490) | 5802399..5802527 | - | 129 | Protein_5434 | integrase | - |
| NP446_RS27495 (NP446_27495) | 5802675..5804903 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| NP446_RS27500 (NP446_27500) | 5804973..5805620 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| NP446_RS27505 (NP446_27505) | 5805682..5806920 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T252901 WP_003117425.1 NZ_CP101912:c5802346-5802068 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|