Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5292087..5292682 | Replicon | chromosome |
Accession | NZ_CP101911 | ||
Organism | Pseudomonas aeruginosa strain NWRC-1223 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | NP444_RS24550 | Protein ID | WP_003113526.1 |
Coordinates | 5292404..5292682 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NP444_RS24545 | Protein ID | WP_003113527.1 |
Coordinates | 5292087..5292392 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP444_RS24520 (NP444_24520) | 5287247..5287582 | + | 336 | WP_256713333.1 | hypothetical protein | - |
NP444_RS24525 (NP444_24525) | 5287592..5287981 | + | 390 | WP_256713334.1 | (deoxy)nucleoside triphosphate pyrophosphohydrolase | - |
NP444_RS24530 (NP444_24530) | 5288574..5288798 | + | 225 | Protein_4844 | HNH endonuclease | - |
NP444_RS24535 (NP444_24535) | 5289173..5290933 | - | 1761 | WP_162598213.1 | HEPN domain-containing protein | - |
NP444_RS24540 (NP444_24540) | 5291337..5291750 | - | 414 | WP_109392601.1 | hypothetical protein | - |
NP444_RS24545 (NP444_24545) | 5292087..5292392 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
NP444_RS24550 (NP444_24550) | 5292404..5292682 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP444_RS24555 (NP444_24555) | 5292735..5292863 | - | 129 | Protein_4849 | integrase | - |
NP444_RS24560 (NP444_24560) | 5293011..5295239 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
NP444_RS24565 (NP444_24565) | 5295309..5295953 | - | 645 | WP_016253921.1 | carbonate dehydratase | - |
NP444_RS24570 (NP444_24570) | 5296015..5297253 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T252893 WP_003113526.1 NZ_CP101911:c5292682-5292404 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|