Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 5176517..5177307 | Replicon | chromosome |
Accession | NZ_CP101910 | ||
Organism | Pseudomonas putida strain ATCC 12633 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | NP430_RS23245 | Protein ID | WP_016497991.1 |
Coordinates | 5176840..5177307 (+) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | I7C311 |
Locus tag | NP430_RS23240 | Protein ID | WP_014859917.1 |
Coordinates | 5176517..5176843 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP430_RS23220 (NP430_23220) | 5172054..5173115 | - | 1062 | WP_016497995.1 | HlyD family secretion protein | - |
NP430_RS23225 (NP430_23225) | 5173144..5174685 | - | 1542 | WP_016497994.1 | MFS transporter | - |
NP430_RS23230 (NP430_23230) | 5174802..5175707 | - | 906 | WP_016497993.1 | LysR family transcriptional regulator | - |
NP430_RS23235 (NP430_23235) | 5175978..5176424 | + | 447 | WP_016497992.1 | universal stress protein | - |
NP430_RS23240 (NP430_23240) | 5176517..5176843 | + | 327 | WP_014859917.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
NP430_RS23245 (NP430_23245) | 5176840..5177307 | + | 468 | WP_016497991.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
NP430_RS23250 (NP430_23250) | 5177380..5178240 | - | 861 | WP_016497990.1 | HlyD family secretion protein | - |
NP430_RS23255 (NP430_23255) | 5178251..5178451 | - | 201 | WP_009685040.1 | DUF1656 domain-containing protein | - |
NP430_RS23260 (NP430_23260) | 5178441..5180618 | - | 2178 | WP_041167558.1 | FUSC family protein | - |
NP430_RS23265 (NP430_23265) | 5180615..5182144 | - | 1530 | WP_016497988.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17879.27 Da Isoelectric Point: 9.6727
>T252887 WP_016497991.1 NZ_CP101910:5176840-5177307 [Pseudomonas putida]
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTRRNAFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRACESSDDAYKVFQKMLHGGHPPDDWDQLLQEAAAD
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTRRNAFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRACESSDDAYKVFQKMLHGGHPPDDWDQLLQEAAAD
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|