Detailed information of TA system TA252878

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/COG4683-HTH_37
• Location: 13609..14266
• Replicon: plasmid pSeFELIX702_3.1
• Accession: NZ_CP101908
• Organism: Salmonella enterica subsp. enterica strain QA-1986 973

Toxin (Protein)

• Gene name: higB
• Uniprot ID: U3PDC3
• Locus tag: NP441_RS23480
• Protein ID: WP_000270043.1
• Coordinates: 13916..14266 (-)
• Length: 117 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: NP441_RS23475
• Protein ID: WP_000124640.1
• Coordinates: 13609..13911 (-)
• Length: 101 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NP441_RS23430 (NP441_23430)	9234..9662	+	429	WP_000591074.1	hypothetical protein	-
NP441_RS23435 (NP441_23435)	9719..10078	+	360	WP_000422768.1	hypothetical protein	-
NP441_RS23440 (NP441_23440)	10078..10524	+	447	WP_000919345.1	Fe3+-siderophore ABC transporter permease	-
NP441_RS23445 (NP441_23445)	10521..11039	+	519	WP_000210756.1	nitrite reductase	-
NP441_RS23450 (NP441_23450)	11039..11269	+	231	WP_000972663.1	hypothetical protein	-
NP441_RS23455 (NP441_23455)	11256..12113	+	858	WP_001167032.1	hypothetical protein	-
NP441_RS23460 (NP441_23460)	12344..12871	+	528	WP_001236377.1	thermonuclease family protein	-
NP441_RS23465 (NP441_23465)	12929..13201	+	273	WP_001043047.1	HU family DNA-binding protein	-
NP441_RS23470 (NP441_23470)	13289..13582	+	294	WP_001239997.1	chromosome segregation protein ParM	-
NP441_RS23475 (NP441_23475)	13609..13911	-	303	WP_000124640.1	XRE family transcriptional regulator	Antitoxin
NP441_RS23480 (NP441_23480)	13916..14266	-	351	WP_000270043.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
NP441_RS23485 (NP441_23485)	14429..14977	+	549	WP_001061574.1	transcriptional regulator	-
NP441_RS23490 (NP441_23490)	15318..15512	+	195	WP_000343597.1	hypothetical protein	-
NP441_RS23495 (NP441_23495)	15523..15894	+	372	WP_000516916.1	hypothetical protein	-
NP441_RS23500 (NP441_23500)	15887..16357	+	471	WP_001281821.1	hypothetical protein	-
NP441_RS23505 (NP441_23505)	16372..16707	-	336	WP_000683476.1	hypothetical protein	-
NP441_RS23510 (NP441_23510)	16804..17292	+	489	WP_001273096.1	DUF1643 domain-containing protein	-
NP441_RS23515 (NP441_23515)	17295..17792	+	498	WP_000062185.1	hypothetical protein	-
NP441_RS23520 (NP441_23520)	18007..18711	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
NP441_RS23525 (NP441_23525)	18776..18955	-	180	Protein_31	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCMY-2 / aadA7 / qacE / sul1	-	1..152311	152311

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-106)

Antitoxin

• Cro/C1-type helix-turn-helix domain (33-79)

Sequences

Toxin

Protein

• Length: 117 a.a.
• Molecular weight: 13328.21 Da
• Isoelectric Point: 5.2421

>T252878 WP_000270043.1 NZ_CP101908:c14266-13916 [Salmonella enterica subsp. enterica]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Nucleotide

• Length: 351 bp

Antitoxin

Protein

• Length: 101 a.a.
• Molecular weight: 11006.73 Da
• Isoelectric Point: 7.2036

>AT252878 WP_000124640.1 NZ_CP101908:c13911-13609 [Salmonella enterica subsp. enterica]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Nucleotide

• Length: 303 bp

Structures

Toxin

• AlphaFold DB: A0A7G8AFB9