Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 3449655..3450193 | Replicon | chromosome |
Accession | NZ_CP101907 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 973 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A7U1Q7V6 |
Locus tag | NP441_RS16855 | Protein ID | WP_001521736.1 |
Coordinates | 3449918..3450193 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A7U1KUN1 |
Locus tag | NP441_RS16850 | Protein ID | WP_000729714.1 |
Coordinates | 3449655..3449915 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP441_RS16835 (3445410) | 3445410..3446963 | + | 1554 | WP_058653096.1 | TROVE domain-containing protein | - |
NP441_RS16840 (3447309) | 3447309..3448523 | + | 1215 | WP_001105525.1 | RNA-splicing ligase RtcB | - |
NP441_RS16845 (3448527) | 3448527..3449546 | + | 1020 | WP_000101027.1 | RNA 3'-terminal phosphate cyclase | - |
NP441_RS16850 (3449655) | 3449655..3449915 | + | 261 | WP_000729714.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NP441_RS16855 (3449918) | 3449918..3450193 | + | 276 | WP_001521736.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NP441_RS16860 (3450281) | 3450281..3452986 | - | 2706 | WP_000907030.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10618.25 Da Isoelectric Point: 9.7714
>T252874 WP_001521736.1 NZ_CP101907:3449918-3450193 [Salmonella enterica subsp. enterica]
MGQRKIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
MGQRKIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1Q7V6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1KUN1 |