Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2895984..2896738 | Replicon | chromosome |
| Accession | NZ_CP101907 | ||
| Organism | Salmonella enterica subsp. enterica strain QA-1986 973 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NP441_RS14255 | Protein ID | WP_000558166.1 |
| Coordinates | 2895984..2896295 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NP441_RS14260 | Protein ID | WP_001259011.1 |
| Coordinates | 2896292..2896738 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP441_RS14225 (2891642) | 2891642..2892544 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| NP441_RS14230 (2892541) | 2892541..2893176 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NP441_RS14235 (2893173) | 2893173..2894102 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NP441_RS14240 (2894149) | 2894149..2894439 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NP441_RS14245 (2894440) | 2894440..2894751 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NP441_RS14250 (2894969) | 2894969..2895898 | + | 930 | WP_001127704.1 | alpha/beta hydrolase | - |
| NP441_RS14255 (2895984) | 2895984..2896295 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NP441_RS14260 (2896292) | 2896292..2896738 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NP441_RS14265 (2896753) | 2896753..2897694 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NP441_RS14270 (2897739) | 2897739..2898176 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| NP441_RS14275 (2898173) | 2898173..2899045 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NP441_RS14280 (2899039) | 2899039..2899638 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NP441_RS14285 (2899829) | 2899829..2900632 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NP441_RS14290 (2900666) | 2900666..2901562 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T252872 WP_000558166.1 NZ_CP101907:2895984-2896295 [Salmonella enterica subsp. enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT252872 WP_001259011.1 NZ_CP101907:2896292-2896738 [Salmonella enterica subsp. enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|