Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1322296..1322891 | Replicon | chromosome |
| Accession | NZ_CP101885 | ||
| Organism | Pseudomonas aeruginosa strain M27432 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | NOQ96_RS06270 | Protein ID | WP_003113526.1 |
| Coordinates | 1322296..1322574 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NOQ96_RS06275 | Protein ID | WP_003133769.1 |
| Coordinates | 1322586..1322891 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOQ96_RS06250 (NOQ96_06250) | 1317721..1318959 | + | 1239 | WP_003095023.1 | C69 family dipeptidase | - |
| NOQ96_RS06255 (NOQ96_06255) | 1319021..1319668 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| NOQ96_RS06260 (NOQ96_06260) | 1319739..1321967 | - | 2229 | WP_023104079.1 | TonB-dependent receptor | - |
| NOQ96_RS06265 (NOQ96_06265) | 1322115..1322243 | + | 129 | Protein_1231 | integrase | - |
| NOQ96_RS06270 (NOQ96_06270) | 1322296..1322574 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NOQ96_RS06275 (NOQ96_06275) | 1322586..1322891 | + | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| NOQ96_RS06285 (NOQ96_06285) | 1323563..1324705 | + | 1143 | WP_023098851.1 | STY4528 family pathogenicity island replication protein | - |
| NOQ96_RS06290 (NOQ96_06290) | 1325306..1326169 | + | 864 | WP_023098850.1 | integrase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T252855 WP_003113526.1 NZ_CP101885:1322296-1322574 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|