Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67811..68064 | Replicon | plasmid p3 |
| Accession | NZ_CP101880 | ||
| Organism | Klebsiella pneumoniae strain KPA1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NNX43_RS27355 | Protein ID | WP_001312851.1 |
| Coordinates | 67915..68064 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 67811..67870 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNX43_RS27320 (63587) | 63587..64447 | + | 861 | WP_000704523.1 | alpha/beta hydrolase | - |
| NNX43_RS27325 (64550) | 64550..65110 | + | 561 | WP_000139321.1 | fertility inhibition protein FinO | - |
| NNX43_RS27330 (65239) | 65239..65451 | + | 213 | WP_001309245.1 | ANR family transcriptional regulator | - |
| NNX43_RS27335 (65696) | 65696..66157 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
| NNX43_RS27340 (66203) | 66203..66412 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| NNX43_RS27345 (66450) | 66450..67040 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| NNX43_RS27350 (67195) | 67195..67668 | + | 474 | WP_016240489.1 | hypothetical protein | - |
| - (67811) | 67811..67870 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (67811) | 67811..67870 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (67811) | 67811..67870 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (67811) | 67811..67870 | - | 60 | NuclAT_1 | - | Antitoxin |
| NNX43_RS27355 (67915) | 67915..68064 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NNX43_RS27360 (68349) | 68349..68597 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| NNX43_RS27365 (68712) | 68712..68896 | + | 185 | Protein_92 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-48 | - | 1..68908 | 68908 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252852 WP_001312851.1 NZ_CP101880:67915-68064 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT252852 NZ_CP101880:c67870-67811 [Klebsiella pneumoniae]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|