Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 67811..68064 Replicon plasmid p3
Accession NZ_CP101880
Organism Klebsiella pneumoniae strain KPA1

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NNX43_RS27355 Protein ID WP_001312851.1
Coordinates 67915..68064 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 67811..67870 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NNX43_RS27320 (63587) 63587..64447 + 861 WP_000704523.1 alpha/beta hydrolase -
NNX43_RS27325 (64550) 64550..65110 + 561 WP_000139321.1 fertility inhibition protein FinO -
NNX43_RS27330 (65239) 65239..65451 + 213 WP_001309245.1 ANR family transcriptional regulator -
NNX43_RS27335 (65696) 65696..66157 + 462 WP_001233838.1 thermonuclease family protein -
NNX43_RS27340 (66203) 66203..66412 + 210 WP_001298565.1 hemolysin expression modulator Hha -
NNX43_RS27345 (66450) 66450..67040 + 591 WP_033807967.1 DUF2726 domain-containing protein -
NNX43_RS27350 (67195) 67195..67668 + 474 WP_016240489.1 hypothetical protein -
- (67811) 67811..67870 - 60 NuclAT_1 - Antitoxin
- (67811) 67811..67870 - 60 NuclAT_1 - Antitoxin
- (67811) 67811..67870 - 60 NuclAT_1 - Antitoxin
- (67811) 67811..67870 - 60 NuclAT_1 - Antitoxin
NNX43_RS27355 (67915) 67915..68064 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NNX43_RS27360 (68349) 68349..68597 + 249 WP_000083839.1 replication regulatory protein RepA -
NNX43_RS27365 (68712) 68712..68896 + 185 Protein_92 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaOXA-48 - 1..68908 68908


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T252852 WP_001312851.1 NZ_CP101880:67915-68064 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT252852 NZ_CP101880:c67870-67811 [Klebsiella pneumoniae]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References